PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K00077.1.p
Common NameEUGRSUZ_K00077
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 350aa    MW: 39402.1 Da    PI: 6.3747
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K00077.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding582.2e-181360148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd +l ++++++G g+W++ +r  g++R++k+c++rw +yl
  Eucgr.K00077.1.p 13 KGPWTPEEDRKLMEYIERHGHGSWRSLPRLAGLNRCGKSCRLRWINYL 60
                      79********************************************97 PP

2Myb_DNA-binding507e-1666111148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++T eE + ++++++ +G++ W++Ia +++ gRt++++k+ w+++l
  Eucgr.K00077.1.p  66 RGNFTDEEKQMIINLHAVYGNK-WSAIATHLP-GRTDNEIKNLWNTHL 111
                       89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.369860IPR017930Myb domain
SuperFamilySSF466895.24E-3210107IPR009057Homeodomain-like
SMARTSM007171.6E-141262IPR001005SANT/Myb domain
PfamPF002494.7E-171360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-251467IPR009057Homeodomain-like
CDDcd001673.03E-111560No hitNo description
PROSITE profilePS5129425.83161115IPR017930Myb domain
SMARTSM007178.4E-1565113IPR001005SANT/Myb domain
PfamPF002492.2E-1466111IPR001005SANT/Myb domain
CDDcd001673.00E-1168111No hitNo description
Gene3DG3DSA:1.10.10.603.1E-2768115IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MESEELNGSS LKKGPWTPEE DRKLMEYIER HGHGSWRSLP RLAGLNRCGK SCRLRWINYL  60
RPDIKRGNFT DEEKQMIINL HAVYGNKWSA IATHLPGRTD NEIKNLWNTH LKKKLLQMGI  120
DPMTHQPRAD LNIFSNLQQL LTLANLLNSN NQFASPLEIN NAMRTLHFQS DSTLLARIQL  180
LSQVFGATGN CNPPPVNNID ALLMNLVGSS SSLSSGHEHR LEDYLKNNRI TNEYSDRFGA  240
GDGLVPSGAF SASTSFEVKE PQLPCNSMLN TGDYPMPFEN SIPPLVCASP GHRVSSISET  300
EKSKMYENSS STSTTTFDRL ELEANNWGDH HQFLDDEVSD SFWNELIRQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-29111155108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K00077.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010034937.10.0PREDICTED: transcription factor MYB3-like
TrEMBLA0A058ZXS30.0A0A058ZXS3_EUCGR; Uncharacterized protein
STRINGVIT_16s0039g01710.t012e-96(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02940.12e-76myb domain protein 107